DPP3 antibody (N-Term)

Catalog No. ABIN632199

This anti-DPP3 antibody is a Rabbit Polyclonal antibody detecting DPP3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DPP3 antibody (N-Term) (ABIN632199)

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPP3 Antibody

Binding Specificity: N-Term

Specificity: DPP3 antibody was raised against the N terminal of DPP3

Purification: Affinity purified

Immunogen: DPP3 antibody was raised using the N terminal of DPP3 corresponding to a region with amino acids SRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPP3 Blocking Peptide, (ABIN5613249), is also available for use as a blocking control in assays to test for specificity of this DPP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPP3

Target: DPP3 (Dipeptidyl-Peptidase 3 (DPP3))

Alternative Name: DPP3

Background: DPP3 is a protein that is a member of the S9B family in clan SC of the serine proteases. This cytoplasmic protein binds a single zinc ion with its zinc-binding motif (HELLGH) and has post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Increased activity of this protein is associated with endometrial and ovarian cancers.

Molecular Weight: 82 kDa (MW of target protein)